Arkan Gilang is a Product Owner and seasoned engineering leader with 8 years of experience building cloud-native, big-data, and AI-enabled systems across startups and enterprises. Currently leading development of an OSINT platform at Aetosky, he owns the product lifecycle from market research and UX to engineering delivery and first client deployments, while standing up teams and go-to-market strategy. Previously he managed engineering teams at Traveloka and architected cloud migrations, CI/CD, and monitoring at Dattabot, blending hands-on data engineering, distributed systems, and blockchain work. Known for turning complex domain needs into pragmatic platform designs, he pairs strong analytical thinking with a curiosity for cutting-edge tech and automation. Based in Jakarta, he holds a Mathematics degree from Universitas Indonesia and has a track record of shipping scalable data pipelines, orchestration layers, and ML-informed automation in production.
8 years of coding experience
12 years of employment as a software developer
S.Si, Mathematics, S.Si, Mathematics at Universitas Indonesia (UI)
file template and reverse template service that watches and sync for changes
Contributions:25 commits, 1 PR, 29 pushes in 1 year 5 months
service-templatetemplatesyncwatcheschanges
Find and Hire Top DevelopersWe’ve analyzed the programming source code of over 60 million software developers on GitHub and scored them by 50,000 skills. Sign-up on Prog,AI to search for software developers.