Exley Mccormick is a Head of Engineering with a decade of experience building research-first front-office systems for event-driven and relative value/arbitrage investing. He combines deep quantitative research skills—dataset creation, statistical analysis, and model validation—with hands-on software design and production engineering, leading the team that integrates academic insight into live trading at CNH/AQR. His background spans valuation and complex securities modeling at EY to environmental and economic research, giving him a rare mix of rigorous quantitative discipline and domain breadth. A Clemson-trained Python developer and outdoors enthusiast based in Greenwich, CT, he is comfortable translating professor-driven research into scalable, auditable production tooling that supports convertible arbitrage and liquidity-provision strategies.
10 years of coding experience
5 years of employment as a software developer
Bachelor of Science (B.S.), BioEngineering, Bachelor of Science (B.S.), BioEngineering at Clemson University
Contributions:3 releases, 1 review, 111 commits in 3 years 9 months
pythonsqlalchemyflaskfilteringflask-sqlalchemy
Find and Hire Top DevelopersWe’ve analyzed the programming source code of over 60 million software developers on GitHub and scored them by 50,000 skills. Sign-up on Prog,AI to search for software developers.
Request Free Trial
Exley Mccormick - Head Of Engineering at CNH Partners, LLC