Jan Monterrubio
Senior Software Engineer II at Cerner Corporation
Olathe, Kansas, United States
Summary
🤩
Rockstar🎓
Top SchoolJan Monterrubio is a Senior Software Engineer II with 11 years of experience building back-end systems and language tooling, currently based in Olathe, Kansas. He has a solid track record at Cerner and C2FO, contributing to production-grade engineering across healthcare and finance domains. An active open-source contributor, Jan has implemented advanced SQL parsing and deparsing features in the widely used JSqlParser and added core language/REPL functionality to the quirky dogescript project, showing both practical parser expertise and a playful curiosity. He holds a BS in Computer Science from the University of New Mexico and combines strong academic grounding with hands-on implementation of compilers, tokenizers, and syntax features. Colleagues describe him as a dependable engineer who tackles tricky parsing edge cases and ships maintainable solutions that bridge libraries and real-world applications.
11 years of coding experience
1 year of employment as a software developer
BS in Computer Science, Computer Science, 3.6, BS in Computer Science, Computer Science, 3.6 at The University of New Mexico
Github Skills (15)
astm10
parserator10
javas10
javascript10
nodejs10
parser10
sql10
java10
repr9
replit9
tokenizer9
compiler-design9
tokenize9
language-design8
programming-language8
Programming languages (20)
Github contributions (5)
dogescript/dogescript
Jun 2017 - Apr 2022
wow so syntax very doge much future
Role in this project:
Back-end Developer
Back-end DeveloperContributions:4 releases, 3 reviews, 149 commits in 4 years 11 months
Contributions summary:Jan contributed to the dogescript project by implementing features, primarily related to the language's core functionality and its REPL environment. They added support for loading dogescript files in the REPL, reading version information from package.json, and implemented new assignment operators and class features. The user also added a tokenizer, allowing the codebase to break down the input into tokens for parsing.
dogegulp-pluginsyntax-highlightingcompletions
JSQLParser/JSqlParser
Mar 2017 - Nov 2020
JSqlParser parses an SQL statement and translate it into a hierarchy of Java classes. The generated hierarchy can be navigated using the Visitor Pattern
Role in this project:Back-end Developer
Back-end DeveloperContributions:5 reviews, 14 commits, 16 PRs in 3 years 9 months
Contributions summary:Jan implemented new features related to SQL parsing and deparsing, including support for `FOR UPDATE WAIT`, `CREATE SEQUENCE`, `ALTER SEQUENCE`, and `IN` clauses with multiple lists. They also introduced support for `CREATE SYNONYM` statements and enhanced the `EXPLAIN` statement with additional options. The commits involved modifying the parser (JJTree), deparser, and associated Java classes within the JSQLParser library.
sqlserverflink-sqlpaypalastvisitor-pattern
Find and Hire Top DevelopersWe’ve analyzed the programming source code of over 60 million software developers on GitHub and scored them by 50,000 skills. Sign-up on Prog,AI to search for software developers.