Kavin Valli
Engineering Intern at Vercel
Waterloo, Ontario, Canada
Summary
🤩
Rockstar🎓
Top SchoolKavin Valli is a full-stack software engineer and University of Waterloo Computer Engineering student with seven years of hands-on experience building web, embedded, and AI-enabled systems. He’s interned at Vercel and Helicone (YC W23), contributing to Rust-based AI gateways, cloud-worker rewrites, and multiple language SDKs while also shipping front-end UX improvements in open-source projects like Typewind. At Arcturus and several startups he bridged embedded vision (i.MX, Jetson) and React/Node platforms, adding features such as event clip saving, zonal object counting, and heatmap visualizations. He combines leadership from running a 100+ member club and leading space society chapters with practical product delivery, often turning research tech (OpenTelemetry, HDBSCAN, LangChain) into production-ready components. Notably, he pairs low-level embedded work with polished frontend UX—an unusual cross-domain strength for an engineer early in their career.
7 years of coding experience
4 years of employment as a software developer
Tagore International School (Vasant Vihar)High School Diploma English Physics Chemistry Maths Computer Science, High School Diploma English Physics Chemistry Maths Computer Science at Delhi Public School - R. K. PuramComputer Engineering, Computer Engineering at University of Waterloo
English, Hindi, Tamil, French
Github Skills (11)
uid10
typescript10
nextjs10
typescripts10
front-end-development10
tailwindcss10
react10
typescript-types10
ui-design9
user-interface8
interface-design8
Programming languages (25)
Github contributions (5)
Mokshit06/typewind
Jan 2023 - Mar 2023
The safety of Typescript with the magic of Tailwind.
Role in this project:
Front-end Developer
Front-end DeveloperContributions:1 review, 59 commits, 2 PRs in 1 month
Contributions summary:Kavin primarily focused on developing the front-end components for the "typewind" project. Their contributions involved setting up the Nextra documentation, creating the home page, and integrating features like feature cards and a demo video. Furthermore, they updated the UI with a better Github button, added support for arbitrary variants, and implemented support for container queries demonstrating a strong emphasis on UI/UX improvements.
tailwindcsstailwindmagicsafetytypescript
exunclan/website-old
Oct 2020 - Aug 2022
The Exun website.
Contributions:3 reviews, 84 commits, 48 PRs in 1 year 9 months
Find and Hire Top DevelopersWe’ve analyzed the programming source code of over 60 million software developers on GitHub and scored them by 50,000 skills. Sign-up on Prog,AI to search for software developers.