Mario Suvajac
Software Architect at ReversingLabs
Zagreb, Croatia
Summary
👤
Senior🎓
Top SchoolMario Suvajac is a software architect with 12+ years of hands-on experience building high-performance C/C++ systems with a strong emphasis on reverse engineering and software security. Based in Zagreb, he architected and developed ReversingLabs' TitaniumCore2 analysis and decomposition engine, created domain-specific languages and toolchains for signature writing, and built internal modern C++ libraries for safe binary manipulation, cryptography and decompression. His background in x86 assembly, disassembly and unpacking informs pragmatic designs that balance performance, safety and portability — including Windows compatibility fixes and mutex/NULL-bug hardening contributed to the widely used YARA project. He mentors engineering teams, delivers trainings and conference talks, and has a long history of freelance reverse-engineering work automating binary analysis. Known for turning low-level research into production-grade tooling, he brings rare expertise at the intersection of deep binary internals and scalable backend architectures.
12 years of coding experience
10 years of employment as a software developer
Donji Miholjac High SchoolMaster of Engineering - MEng, Mechanical Engineering, Master of Engineering - MEng, Mechanical Engineering at Josip Juraj Strossmayer University of Osijek
English
Github Skills (7)
c1710
debug10
c1110
yara10
performance-optimization10
c-language4
cprogramming-language4
Programming languages (2)
Github contributions (5)
VirusTotal/yara
Jan 2014 - Sep 2019
The pattern matching swiss knife
Role in this project:
Back-end Developer
Back-end DeveloperContributions:18 commits, 4 PRs, 3 comments in 5 years 9 months
Contributions summary:Mario primarily contributed to bug fixes and performance improvements within the YARA codebase. Their work involved fixing mutex leaks, addressing NULL pointer dereferences, and correcting structure member typos. They also made modifications to improve code efficiency and ensure compatibility with Windows systems. Furthermore, the user integrated documentation updates by merging the remote-tracking branch.
yaramatchingknifepattern-matchingpattern
msuvajac/yara
Oct 2015 - Sep 2019
A malware identification tool
Contributions:8 PRs, 52 pushes, 14 branches in 3 years 11 months
securitymalwareidentification
Find and Hire Top DevelopersWe’ve analyzed the programming source code of over 60 million software developers on GitHub and scored them by 50,000 skills. Sign-up on Prog,AI to search for software developers.