Neal Ormsbee is a Staff Software Engineer with over a decade of hands-on experience building self-hosted B2B applications, primarily in healthcare research and cloud cost management. Based in Albuquerque, he has progressed from co-founding a web/mobile startup to senior engineering roles and people leadership at Kubecost, now focusing on AI-enablement and special projects. Neal combines full-stack craftsmanship with backend expertise in cost modeling—his open-source contributions to the popular opencost project improved asset aggregation and credit handling for Kubernetes cost monitoring. He excels at automating tedious work, coaching teams, and shipping reliable products that meet complex domain needs. Notably, his background spans computational biology product development and university edtech, giving him a rare mix of regulated-industry rigor and academic collaboration experience. Colleagues know him as a pragmatic problem-solver who turns messy operational challenges into maintainable systems.
11 years of coding experience
9 years of employment as a software developer
Wekiva High School
Partial Bachelors Computer Information Sciences & Engineering, Partial Bachelors Computer Information Sciences & Engineering at University of Florida
Cost monitoring for Kubernetes workloads and cloud costs
Role in this project:
Back-end Developer
Contributions:4 releases, 49 reviews, 79 commits in 2 years
Contributions summary:Neal primarily focused on enhancing the `opencost/opencost` project's asset management and cost aggregation capabilities. They refactored the `AssetSet` data structure, implementing the aggregation of assets by label, and the inclusion of a concept for applying credits to assets. The changes involved modifications to the `asset.go` and `asset_test.go` files, indicating a focus on improving how the system handles and processes cost data related to Kubernetes resources. Furthermore, they made code adjustments in the `costmodel` and `allocation` packages, demonstrating a deep understanding of the project's core cost modeling functionality and related integration points.
A small Flask/SQLAlchemy app demonstrating how some routes might be implemented with and without Graphene-SQLAlchemy and Flask-Graphene
Contributions:2 PRs, 8 pushes, 1 branch in 2 years 8 months
pythonsqlalchemygraphene-flaskflaskroutes
Find and Hire Top DevelopersWe’ve analyzed the programming source code of over 60 million software developers on GitHub and scored them by 50,000 skills. Sign-up on Prog,AI to search for software developers.