AVP Of Basketball Research & Insight at Spurs Sports & Entertainment
San Antonio, Texas, United States
Join Prog.AI to see contacts
Join Prog.AI to see contacts
Summary
👤
Senior
🎓
Top School
Nick Repole is an AVP of Basketball Research & Insight with 11 years building analytics, systems and data engineering capabilities for NBA organizations. He progressed through technical and leadership roles at Spurs Sports & Entertainment after early quantitative and product-development experience with the Charlotte Hornets and Eagle Investment Systems, translating complex basketball and business questions into production analytics and operational systems. A University of Michigan computer science graduate, he pairs software engineering chops (Python, SQL, web stacks and automation) with domain expertise in tracking, modeling, and insight delivery for basketball operations. Known for moving prototypes into reliable team tools, he blends research-driven experimentation with practical systems design to inform coaching and front-office decisions.
11 years of coding experience
13 years of employment as a software developer
Bachelor of Science in Engineering (B.S.E.), Computer Science, Bachelor of Science in Engineering (B.S.E.), Computer Science at University of Michigan
GraphQL type features in a REST API using SQLAlchemy and Marshmallow.
Contributions:140 commits, 16 PRs, 124 pushes in 6 years 7 months
apipythonsqlalchemytype-graphqlfastapi
Find and Hire Top DevelopersWe’ve analyzed the programming source code of over 60 million software developers on GitHub and scored them by 50,000 skills. Sign-up on Prog,AI to search for software developers.
Request Free Trial
Nick Repole - AVP Of Basketball Research & Insight at Spurs Sports & Entertainment