Omar Camarena
Development Engineer at Kallpa Generación S.A.
Peru
Summary
🤩
Rockstar🎓
Top SchoolOmar Camarena is a development engineer with 11 years of experience focused on renewable energy projects and asset planning, currently contributing to Kallpa Generación in Peru. He combines hands-on operations and planning experience—from managing SAP-driven invoicing and PR/PO workflows on large-scale power operations to supporting forecasting and asset valuations—with recent specialization in renewable energies through ESAN. Comfortable bridging field operations and technical systems, Omar has improved operational controls and reporting in roles at Stork/Fluor and Enel projects, demonstrating strong database and process automation skills. He also contributes to open-source tooling, enhancing an Emacs Lisp consulting package with practical UX and backend improvements, showing curiosity for developer ergonomics beyond his energy domain. Fluent in Spanish with intermediate English, Omar brings a pragmatic, systems-oriented approach and a history of founding and leading student initiatives, hinting at both entrepreneurial drive and team leadership.
11 years of coding experience
1 year of employment as a software developer
Nivel Intermedio, Ingles, Nivel Intermedio, Ingles at ICPNADiplomatura, Diploma de Especialización en Energías Renovables, Diplomatura, Diploma de Especialización en Energías Renovables at ESAN Graduate School of BusinessIngeniería, Ingeniería mecánica, Ingeniería, Ingeniería mecánica at Universidad Nacional de Ingeniería
Github Skills (4)
completions10
lisp10
emacs-lisp10
elisp9
Programming languages (9)
Github contributions (5)
minad/consult
Dec 2020 - Feb 2022
:mag: consult.el - Consulting completing-read
Role in this project:
Back-end Developer
Back-end DeveloperContributions:25 reviews, 18 commits, 22 PRs in 1 year 2 months
Contributions summary:Omar primarily contributed to enhancing the `consult.el` Emacs Lisp package. Their work involved implementing new functionalities such as file opening, command execution from major/minor modes, and line manipulation. They also addressed identified bugs and improved user experience by incorporating previews and addressing issues related to completion in the region. The contributions focused on improving the functionality and usability of the Emacs package.
emacsmagcompletionconsulting
oantolin/embark
May 2020 - Jan 2023
Emacs Mini-Buffer Actions Rooted in Keymaps
Contributions:11 releases, 85 reviews, 1213 commits in 2 years 8 months
bufferspacemacsemacskeymapsemacs-lsp
Find and Hire Top DevelopersWe’ve analyzed the programming source code of over 60 million software developers on GitHub and scored them by 50,000 skills. Sign-up on Prog,AI to search for software developers.