Ratish Philip is a Senior Software Engineer in the San Francisco Bay Area with 15+ years of experience building rich Windows and web applications using .NET, C#, ASP.NET Core and WPF. He blends hands-on UI expertise (MVVM, n-tier, custom WPF styling) with backend rigor, proven by contributions to Microsoft-backed CommunityToolkit repos where he added geometry helpers, tests, and managed merges. Creator of popular open-source projects like NVM Sharp, CompositionProToolkit and WPFSpark, he focuses on reusable components that simplify Windows UI and composition scenarios. Ratish has delivered enterprise-grade software for customers including DocuSign, Wells Fargo and Philips Healthcare, often translating domain requirements into polished, user-centric interfaces. He is active in the Windows developer community and the Windows Insider program, combining product-quality engineering with continual exploration of platform capabilities.
11 years of coding experience
17 years of employment as a software developer
St. Xavier's School, Bokaro
B.Tech, Information Technology, B.Tech, Information Technology at University of Kerala
ARCHIVE - New Repo: https://aka.ms/toolkit/windows
Role in this project:
Full-stack Developer
Contributions:39 reviews, 43 commits, 3 PRs in 4 months
Contributions summary:Ratish primarily contributed to the sample application, focusing on implementing and enhancing UI elements and behaviors. Their work included adding new features like the Win2D path geometry parser, creating and integrating various geometry helper functions and test cases. The commits show their involvement in the UI, demonstrating skills in XAML and potentially related C# components within the context of the Windows Community Toolkit.
.NET Community Toolkit is a collection of helpers and APIs that work for all .NET developers and are agnostic of any specific UI platform. The toolkit is maintained and published by Microsoft, and part of the .NET Foundation.
Role in this project:
Back-end Developer
Contributions:8 commits in 1 month
Contributions summary:Ratish primarily contributed to the project by adding unit test cases for geometry helpers and integrating changes related to string pooling. They also merged several branches into the main branch, indicating they likely managed code integration and resolved conflicts. Additionally, they modified the ThrowHelper class, demonstrating involvement in exception handling and utility functions.
dotnetcsharpmvvmnetstandardnetframework
Find and Hire Top DevelopersWe’ve analyzed the programming source code of over 60 million software developers on GitHub and scored them by 50,000 skills. Sign-up on Prog,AI to search for software developers.