Sergei Shmakov is a Senior Frontend Engineer with 13 years of software experience and seven focused on building scalable, high-performance TypeScript and React applications. At Kontur he accelerated cross-service feature delivery, re-architected form engines to improve large-form INP by 100x, and created reusable domain abstractions that boosted code reuse to 80%. He combines hands-on implementation—shipping a two-week Airbnb integration and an embeddable widget that doubled sub-product sales—with platform-level improvements like workspace migration and automated linting that raised team velocity. A former tech co-founder, Sergei also built analytics and ad integrations for lead-generation products, bringing product sensibility to engineering decisions. Based in Yekaterinburg, he is known for pragmatic automation, mentoring engineers, and translating complex domain workflows into reusable frontend primitives.
13 years of coding experience
9 years of employment as a software developer
Инженер, Сети связи и системы коммутации, Инженер, Сети связи и системы коммутации at Уральский Государственный Технический Университет
.NET library implementing distributed task queue machinery using Apache Cassandra
Contributions:32 commits in 1 year 10 months
net-librarymachinerycassandraapachetask-queue
Find and Hire Top DevelopersWe’ve analyzed the programming source code of over 60 million software developers on GitHub and scored them by 50,000 skills. Sign-up on Prog,AI to search for software developers.
Request Free Trial
Sergei Shmakov - Senior Frontend Engineer at СКБ Контур